PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 273aa    MW: 31528.3 Da    PI: 6.4215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32100.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.6e-15862148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqkyl 48
                     rg+WT++Ed +lv  v ++G ++W+ Ia+  g       ++Rt+k+c++rw +yl
       KHN32100.1  8 RGPWTEQEDYKLVYFVGMFGDRRWDFIAKVSGlkvegdcLNRTGKSCRLRWVNYL 62
                     89***************************************************97 PP

2Myb_DNA-binding51.13e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E+ l  d++ ++G++ W++Iar+++ gRt++++k++w++++
       KHN32100.1  68 RGKLTPQEQHLVMDLHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 113
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.787362IPR017930Myb domain
SuperFamilySSF466891.05E-275109IPR009057Homeodomain-like
SMARTSM007173.7E-13764IPR001005SANT/Myb domain
PfamPF002493.5E-13862IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-19968IPR009057Homeodomain-like
CDDcd001679.74E-91062No hitNo description
PROSITE profilePS5129426.61763117IPR017930Myb domain
SMARTSM007174.4E-1367115IPR001005SANT/Myb domain
PfamPF002492.2E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2369116IPR009057Homeodomain-like
CDDcd001671.17E-872113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MVQQDIRRGP WTEQEDYKLV YFVGMFGDRR WDFIAKVSGL KVEGDCLNRT GKSCRLRWVN  60
YLHPDLKRGK LTPQEQHLVM DLHSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKKALE  120
KKHASASASS PVSSSCQSSL SSNNHVVDSH ASKESFYDTG GYDDMMMGLI GGEKGYSMDD  180
IWKDIVLSGE ENSIYNNNNL QPVYEEGHSE EGCNFSCPPP MMIMPSPPSW DQYNISSQPL  240
WVMDEEESNK MLFPTLSDQY FSHYEQGNEF LTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2651161104MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-2681164104C-Myb DNA-Binding Domain
1msf_C2e-2681164104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0972740.0BT097274.1 Soybean clone JCVI-FLGm-21F20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592208.10.0PREDICTED: transcription factor MYB59-like
SwissprotQ4JL841e-73MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A0B2RFM00.0A0A0B2RFM0_GLYSO; Transcription factor MYB59
STRINGGLYMA12G07110.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43783359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-69myb domain protein 59
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]